Comparison

Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

Item no. CSB-YP317813MO-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELI EDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCC SEDLCNAAVPTAG
Citations "B cells express Ly-6C in a Th1 but not Th2 cytokine environment."
Schlueter A.J., Krieg A.M., De Vries P., Li X.
J. Interferon Cytokine Res. 22:799-806(2002)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
11.1 kDa
Expression Region
27-109aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Cell membrane, Lipid-anchor, GPI-anchor
Gene Names
Ly6c1
Sequence Info
Full Length of Mature Protein
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close