Comparison

Recombinant Momordica charantia Ribosome-inactivating protein momordin I

Item no. CSB-YP321420MHQ-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DVSFRLSGADPRSYGMFIKDLRNALPFREKVYNIP LLLPSVSGAGRYLLMHLFNYDGKTITVAVDVTNVY IMGYLADTTSYFFNEPAAELASQYVFRDARRKITL PYSGNYERLQIAAGKPREKIPIGLPALDSAISTLL HYDSTAAAGALLVLIQTTAEAARFKYIEQQIQERA YRDEVPSLATISLENSWSGLSKQIQLAQGNNGIFR TPIVLVDNKGNRVQITNVTSKVVTSNIQLLLNTRN
Protein Family Ribosome-inactivating protein family, Type 1 RIP subfamily
Citations Cleavage of nicotinamide adenine dinucleotide by the ribosome-inactivating protein from Momordica charantia.Vinkovic M., Dunn G., Wood G.E., Husain J., Wood S.P., Gill R.Acta Crystallogr F Struct Biol Commun 71:1152-1155(2015)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Alpha-momorcharin; Short name:; Alpha-MMC; rRNA N-glycosidase
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
29.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Endohydrolysis of the N-glycosidic bond at one specific adenosine on the 28S rRNA
Expression Region
24-269aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Sequence Info
Full Length of Mature Protein
Organism
Momordica charantia (Bitter gourd) (Balsam pear)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close