« Back
Home /
Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

Item no.	CSB-YP323576ZAB-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQT QSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGST SPRMLTPINEEADPLDDADDETSSLPPLESDDEEQ DRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQD QDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPF DAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYP PWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFM AIL
Citations	"The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein." Huang Y., Xu L., Sun Y., Nabel G.J. Mol. Cell 10:307-316(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nucleocapsid protein
Available
Manufacturer - Targets	NP
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	31.1 kDa
Relevance	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.
Expression Region	488-739aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP323576ZAB-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer