« Back
Home /
Recombinant Escherichia coli Transcriptional regulatory protein PhoP(phoP)

Recombinant Escherichia coli Transcriptional regulatory protein PhoP(phoP)

Item no.	CSB-YP326097ENV-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Metabolism Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKE ADYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSND VSLPILVLTARESWQDKVEVLSAGADDYVTKPFHI EEVMARMQALMRRNSGLASQVISLPPFQVDLSRRE LSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLM LQLYPDAELRESHTIDVLMGRLRKKIQAQYPQEVI TTVRGQGYLFELR
Citations	"Escherichia coli purB gene: cloning, nucleotide sequence, and regulation by purR." He B., Smith J.M., Zalkin H. J. Bacteriol. 174:130-136(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Targets	phoP
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.0 kDa
Relevance	Member of the two-component regulatory system PhoP/PhoQ involved in adaptation to low Mg2+ environments and the control of acid resistance genes. In low periplasmic Mg2+, PhoQ phosphorylates PhoP, resulting in the expression of PhoP-activated genes (PAG) and repression of PhoP-repressed genes (PRG). In high periplasmic Mg2+, PhoQ dephosphorylates phospho-PhoP, resulting in the repression of PAG and may lead to expression of some PRG. Mediates magnesium influx to the cytosol by activation of MgtA. Promotes expression of the two-component regulatory system rstA/rstB and transcription of the hemL, mgrB, nagA, slyB, vboR and yrbL genes.
Expression Region	1-223aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Member of the two-component regulatory system PhoP/PhoQ involved in adaptation to low Mg(2+) environments and the control of acid resistance genes. In low periplasmic Mg(2+), PhoQ phosphorylates PhoP, resulting in the expression of PhoP-activated genes (PAG) and repression of PhoP-repressed genes (PRG). In high periplasmic Mg(2+), PhoQ dephosphorylates phospho-PhoP, resulting in the repression of PAG and may lead to expression of some PRG (By similarity). Mediates magnesium influx to the cytosol by activation of MgtA. Promotes expression of the two-component regulatory system rstA/rstB and transcription of the hemL, mgrB, nagA, slyB, vboR and yrbL genes.
Subcellular Location	Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP326097ENV-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time