« Back
Home /
Recombinant Malus domestica Major allergen Mal d 1(MALD1)

Recombinant Malus domestica Major allergen Mal d 1(MALD1)

Item no.	CSB-YP331771MPS-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHR IDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV ACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAH GLFKLIESYLKDHPDAYN
Protein Family	BetVI family
Citations	"Cloning and sequencing of Mal d 1, the major allergen from apple (Malus domestica), and its immunological relationship to Bet v 1, the major birch pollen allergen."Vanek-Krebitz M., Hoffmann-Sommergruber K., Laimer da Camara Machado M., Susani M., Ebner C., Kraft D., Scheiner O., Breiteneder H.Biochem. Biophys. Res. Commun. 214:538-551(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Mal d I; Allergen: Mal d 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	19.5 kDa
General Research Areas	Allergen
Expression Region	2-159aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	MALD1
Sequence Info	Full Length of Mature Protein
Organism	Malus domestica (Apple) (Pyrus malus)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP331771MPS-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer