« Back
Home /
Recombinant Porphyromonas gingivalis Gingipain R1(rgpA),partial

Recombinant Porphyromonas gingivalis Gingipain R1(rgpA),partial

Item no.	CSB-YP338957PQP-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRG LRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDL TYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHY NEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDK WLGQALCIASAEGGPSADNGESDIQHENVIANLLT QYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTG HGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACV NGD
Protein Family	Peptidase C25 family
Citations	Structural characterization of argingipain, a novel arginine-specific cysteine proteinase as a major periodontal pathogenic factor from Porphyromonas gingivalis.Okamoto K., Misumi Y., Kadowaki T., Yoneda M., Yamamoto K., Ikehara Y.Arch. Biochem. Biophys. 316:917-925(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Arg-gingipain;Gingipain 1RGP-1
Available
Manufacturer - Targets	rgpA
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56 kDa
Relevance	Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complent C3 and C5.
Expression Region	228-720aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Thiol protease. Acts synergistically with RgpB to catalyze the maturation of fimbrial subunits, such as FimA (By similarity). Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms (Probable).
Subcellular Location	Secreted
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP338957PQP-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer