Comparison

Recombinant Human Peroxiredoxin-2(PRDX2)

Item no. CSB-YP339235HU-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGK YVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCE VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLAD VTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQI TVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGW KPGSDTIKPNVDDSKEYFSKHN
Protein Family Peroxiredoxin family, AhpC/Prx1 subfamily
Citations The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions.
Lim Y.-S., Cha M.-K., Kim H.-K., Kim I.-H.
Gene 140:279-284(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Natural killer cell-enhancing factor B
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
23.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Neuroscience
Relevance
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Expression Region
2-198aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Subcellular Location
Cytoplasm
Paythway
Cellageingandmetabolism
Gene Names
PRDX2
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close