« Back
Home /
Recombinant Clostridium botulinum Botulinum neurotoxin type F(botF),partial

Recombinant Clostridium botulinum Botulinum neurotoxin type F(botF),partial

Item no.	CSB-YP341192CLQ-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYK AFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSS AYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGK VLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIK LSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLID PDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGH NSSTESFIADPAISLAHELIHALHGLYGARGVTYE ETI
Protein Family	Peptidase M27 family
Citations	Sequence of the gene encoding type F neurotoxin of Clostridium botulinum.East A.K., Richardson P.T., Allaway D., Collins M.D., Roberts T.A., Thompson D.E.FEMS Microbiol. Lett. 75:225-230(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bontoxilysin-F
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.6 kDa
Relevance	Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '58-Gln-\|-Lys-59' bond of synaptobrevins-1 and -2.
Expression Region	1-436aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '58-Gln-\|-Lys-59' bond of synaptobrevins-1 and -2.
Subcellular Location	Botulinum neurotoxin F light chain: Secreted, Host cytoplasm, host cytosol, SUBCELLULAR LOCATION: Botulinum neurotoxin F heavy chain: Secreted, Host cell junction, host synapse, host presynaptic cell membrane
Gene Names	botF
Sequence Info	Partial
Organism	Clostridium botulinum
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP341192CLQ-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer