Comparison

Recombinant Escherichia coli RNA-splicing ligase RtcB(rtcB)

Item no. CSB-YP341647ENV-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNYELLTTENAPVKMWTKGVPVEADARQQLINTAK MPFIFKHIAVMPDVHLGKGSTIGSVIPTKGAIIPA AVGVDIGCGMNALRTALTAEDLPENLAELRQAIET AVPHGRTTGRCKRDKGAWENPPVNVDAKWAELEAG YQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLD ESDQVWIMLHSGSRGIGNAIGTYFIDLAQKEMQET LETLPSRDLAYFMEGTEYFDDYLKAVAWAQLFASL NRD
Protein Family RtcB family
Citations The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
47.2 kDa
Relevance
RNA ligase that mediates the joining of broken tRNA-like st-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like st-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP . Also acts as a DNA ligase in case of DNA damage by splicing 'dirty' DNA breaks, characterized by 3'-PO4 (or cyclic-PO4) and 5'-OH ends that cannot be sealed by classical DNA ligases .
Expression Region
1-408aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
RNA ligase that mediates the joining of broken tRNA-like stem-loop structures in case of tRNA damage. Probably participates to tRNA restriction-repair by ligating broken tRNA-like stem-loop structures with 2', 3'-cyclic phosphate and 5'-OH ends to form a splice junction with a 2'-OH, 3', 5'-phosphodiester, a step that requires GTP
Gene Names
rtcB
Sequence Info
Full Length
Organism
Escherichia coli (strain K12)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close