Comparison

Recombinant Mycobacterium tuberculosis Steroid C26-monooxygenase(cyp125)

Item no. CSB-YP351308MVZ-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYA ERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGF WAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIA REDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAV GRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELP LQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAH IDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQ ADI
Protein Family Cytochrome P450 family
Citations Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.Cole S.T., Brosch R., Parkhill J., Garnier T., Churcher C.M., Harris D.E., Gordon S.V., Eiglmeier K., Gas S., Barry C.E. III, Tekaia F., Badcock K., Basham D., Brown D., Chillingworth T., Connor R., Davies R.M., Devlin K. , Feltwell T., Gentles S., Hamlin N., Holroyd S., Hornsby T., Jagels K., Krogh A., McLean J., Moule S., Murphy L.D., Oliver S., Osborne J., Quail M.A., Rajandream M.A., Rogers J., Rutter S., Seeger K., Skelton S., Squares S., Squares R., Sulston J.E., Taylor K., Whitehead S., Barrell B.G.Nature 393:537-544(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cholest-4-en-3-one 26-monooxygenaseCytochrome P450 125Steroid C27-monooxygenase
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
50.4 kDa
Relevance
Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.
Expression Region
1-433aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection
Gene Names
cyp125
Sequence Info
Full Length
Organism
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close