Comparison

Recombinant Human papillomavirus type 18 Regulatory protein E2(E2)

Item no. CSB-YP361949HMN-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQ YWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISK SKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEEL WNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDS VYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIE FKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDD TVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSA ATR
Protein Family Papillomaviridae E2 protein family
Citations Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products.Cole S.T., Danos O.J. Mol. Biol. 193:599-608(1987)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43.3 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
E2 regulates viral transcription and DNA replication. It binds to the E2RE response elent (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory region. It can either activate or repress transcription depending on E2RE's position with regards to proximal promoter elents. Repression occurs by sterically hindering the assbly of the transcription initiation complex. The E1-E2 complex binds to the origin of DNA replication.
Expression Region
1-365aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
Subcellular Location
Host nucleus
Gene Names
E2
Sequence Info
Full Length
Organism
Human papillomavirus type 18

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close