« Back
Home /
Recombinant Human Inactive tyrosine-protein kinase 7 (PTK7),partial

Recombinant Human Inactive tyrosine-protein kinase 7 (PTK7),partial

Item no.	CSB-YP622651HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYW LLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQ CVARDDVTGEEARSANASFNIKWIEAGPVVLKHPA SEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLS DGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSA FGQACSSQNFTLSIADESFARVVLAPQDVVVARYE EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHL RRA
Protein Family	Protein kinase superfamily, Tyr protein kinase family, Insulin receptor subfamily
Citations	Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family.Mossie K., Jallal B., Alves F., Sures I., Plowman G.D., Ullrich A.Oncogene 11:2179-2184(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Colon carcinoma kinase 4 ;CCK-4Protein-tyrosine kinase 7Pseudo tyrosine kinase receptor 7Tyrosine-protein kinase-like 7
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	76.6 kDa
General Research Areas	Cell Adhesion
Relevance	Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in bryogenesis, epithelial tissue organization and angiogenesis.
Expression Region	31-704aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.
Subcellular Location	Membrane, Single-pass type I membrane protein, Cell junction
Tissue Specificity	Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.
Biologically active	Not Test
Protein length	Extracellular Domain

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP622651HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer