« Back
Home /
Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

Recombinant Escherichia coli Chaperone protein DnaK(dnaK)

Item no.	CSB-YP633459EGW-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neuroinflammation Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRT TPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIK RLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEV KGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVI TVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAA ALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEV DGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK KDQ
Protein Family	Heat shock protein 70 family
Citations	"Identification of genes subject to positive selection in uropathogenic strains of Escherichia coli: a comparative genomics approach." Chen S.L., Hung C.-S., Xu J., Reigstad C.S., Magrini V., Sabo A., Blasiar D., Bieri T., Meyer R.R., Ozersky P., Armstrong J.R., Fulton R.S., Latreille J.P., Spieth J., Hooton T.M., Mardis E.R., Hultgren S.J., Gordon J.I.Proc. Natl. Acad. Sci. U.S.A. 103:5977-5982(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSP70 ; Heat shock 70KDA protein ; Heat shock protein 70
Available
Manufacturer - Targets	dnaK
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	71.1 kDa
General Research Areas	Signal Transduction
Relevance	Acts as a chaperone.
Expression Region	1-638aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a chaperone.
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP633459EGW-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer