Comparison

Recombinant Human Fc receptor-like protein 6(FCRL6),partial

Item no. CSB-YP718779HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYR DGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMY IPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPRE GSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDR GPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSP QLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCE AQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFP VKS
Citations "FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection."Wilson T.J., Presti R.M., Tassi I., Overton E.T., Cella M., Colonna M.Blood 109:3786-3793(2007)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc receptor homolog 6; Short name:FcRH6; IFGP6
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
33.7 kDa
General Research Areas
Immunology
Expression Region
20-307aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a MHC class II receptor
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level) (PubMed:17213291, PubMed:18991291, PubMed:20933011). Also expressed in gamma delta T cells and in a rare subset of effector CD4(+) T-cells (at protein level) (PubMed:18991291). Expressed in spleen, skin, peripheral blood leukocytes, liver, lung, bone marrow, small intestine and placenta (PubMed:20933011). Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8(+) T-cells but also populations of CD4(+) T-cells (PubMed:17213291, PubMed:20933011). Expression among CD8(+) T-cells and NK cells is expanded in individuals with chronic lymphocytic leukemia (CLL) but is reduced in PBMCs from patients with acute (AML), chronic myeloid leukemia (CML) and non-Hodgkin's lymphoma (PubMed:18991291, PubMed:20933011). Expression is higher in PBMCs and/or CD3(+) cells of patients with autoimmune diseases, such as rheumatoid arthritis (RA), systemic lupus erythematosus (SLE) and idiopathic thrombocytopenia purpura (ITP) (PubMed:20933011). In contrast, expression in CD3(+) cells from patients with lupus anticoagulans (LA) is higher (PubMed:20933011).
Gene Names
FCRL6
Sequence Info
Extracellular Domain
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close