« Back
Home /
Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial

Recombinant Mouse Histone deacetylase complex subunit SAP130(Sap130),partial

Item no.	CSB-YP807359MO-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKA EKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRN PWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVS CRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEG IIPKKKAATDDDLHRINELIQGNMQRCKLVMDQIS EARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRK EKV
Protein Family	SAP130 family
Citations	"Mincle is an ITAM-coupled activating receptor that senses damaged cells."Yamasaki S., Ishikawa E., Sakuma M., Hara H., Ogata K., Saito T.Nat. Immunol. 9:1179-1188(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	130KDA Sin3-associated polypeptide; Sin3-associated polypeptide p130
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.8 kDa
Relevance	Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes
Expression Region	845-1057aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes (By similarity).
Subcellular Location	Nucleus
Gene Names	Sap130
Sequence Info	Partial
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP807359MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer