Comparison

Recombinant Mouse Angiopoietin-like protein 8(Angptl8)

Item no. CSB-YP844436MO-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VRPAPVAPLGGPEPAQYEELTLLFHGALQLGQALN GVYRATEARLTEAGHSLGLYDRALEFLGTEVRQGQ DATQELRTSLSEIQVEEDALHLRAEATARSLGEVA RAQQALRDTVRRLQVQLRGAWLGQAHQEFETLKAR ADKQSHLLWALTGHVQRQQREMAEQQQWLRQIQQR LHTAALPA
Protein Family ANGPTL8 family
Citations Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Betatrophin1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
22.5 kDa
Relevance
Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels . May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state . According to a report, may act by promoting ANGPTL3 cleavage . According to another study, not required for cleavage of ANGPTL3 .
Expression Region
16-198aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels
Subcellular Location
Secreted
Tissue Specificity
Expressed in liver and fat. Enriched in white and brown adipose tissues.
Gene Names
Angptl8
Sequence Info
Full Length of Mature Protein
Organism
Mus musculus (Mouse)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close