Comparison

Recombinant Staphylococcus aureus Staphopain B(sspB)

Item no. CSB-YP859203SKX-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNA TKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQM IEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMI LAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYW NPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Protein Family Peptidase C47 family
Citations "Genetic characterization of staphopain genes in Staphylococcus aureus."
Golonka E., Filipek R., Sabat A., Sinczak A., Potempa J.
Biol. Chem. 385:1059-1067(2004)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Staphylococcal cysteine proteinase B; Staphylopain B
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
21.9 kDa
Relevance
Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues
Expression Region
220-393aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues (By similarity).
Subcellular Location
Secreted
Gene Names
sspB
Sequence Info
Full Length of Mature Protein
Organism
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close