« Back
Home /
Recombinant Human Interleukin-26(IL26)

Recombinant Human Interleukin-26(IL26)

Item no.	CSB-YP873613HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Glucose Homeostasis Neural Transcription Factors Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Solid
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATI PEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFME DVFGQLQLQGCKKIRFVEDFHSLRQKLSHCISCAS SAREMKSITRMKRIFYRIGNKGIYKAISELDILLS WIKKLLESSQ
Protein Family	IL-10 family
Citations	"Induction of a novel cellular homolog of interleukin-10, AK155, by transformation of T lymphocytes with herpesvirus saimiri."Knappe A., Hor S., Wittmann S., Fickenscher H.J. Virol. 74:3881-3887(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein AK155
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	19.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin
Expression Region	22-171aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin.
Subcellular Location	Secreted
Tissue Specificity	Expressed in HVS transformed T-cells but not other T-cell lines or primary stimulated T-cells. Expressed in colonic T-cells including Th17 inflammatory T-cells; the expression is significantly increased in serum of patients with Crohn's disease (at protein level).
Gene Names	IL26
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Manufacturer - Format	Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP873613HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 12/18/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer