« Back
Home /
Recombinant Human Histone-lysine N-methyltransferase NSD3(NSD3)

Recombinant Human Histone-lysine N-methyltransferase NSD3(NSD3)

Item no.	CSB-YP880145HU-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFD NNSDIAEDGGQTPYEATLQQGFQYPATTEDLPPLT NGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRN FSPTDYYHSEIPNTRPHEILEKPSPPQPPPPPSVP QTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGD LLNEVQASEHTKSKHESRKEKRKKSNKHDSSRSEE RKSHKIPKLEPEEQNRPNERVDTVSEKPREEPVLK EEA
Protein Family	Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SET2 subfamily
Citations	WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3. Stec I., van Ommen G.-J.B., den Dunnen J.T. Genomics 76:5-8(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nuclear SET domain-containing protein 3 (Protein whistle) (WHSC1-like 1 isoform 9 with methyltransferase activity to lysine) (Wolf-Hirschhorn syndrome candidate 1-like protein 1) (WHSC1-like protein 1) (WHSC1L1)
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.9 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Expression Region	1-645aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Subcellular Location	Nucleus, Chromosome
Tissue Specificity	Highly expressed in brain, heart and skeletal muscle. Expressed at lower level in liver and lung.
Involvement in disease	Defects in NSD3 may be involved in non small cell lung carcinomas (NSCLC). Amplified or overexpressed in NSCLC.
Gene Names	WHSC1L1
Sequence Info	Full Length of Isoform 3
Organism	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP880145HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer