« Back
Home /
Recombinant Human Actin-like protein 8(ACTL8)

Recombinant Human Actin-like protein 8(ACTL8)

Item no.	CSB-YP887982HU-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNY LPCKENPGPSYARRRVSLGIDICHPDTFSYPIERG RILNWEGVQYLWSFVLENHRREQEVPPVIITETPL REPADRKKMLEILFELLHVPSVLLADQLQMSLYAS GLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEF AGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMN KCYVPQNLGEALDFRERQQSALDESNTYQLPDGSR VEL
Protein Family	Actin family
Citations	"A human interactome in three quantitative dimensions organized by stoichiometries and abundances." Hein M.Y., Hubner N.C., Poser I., Cox J., Nagaraj N., Toyoda Y., Gak I.A., Weisswange I., Mansfeld J., Buchholz F., Hyman A.A., Mann M. Cell 163:712-723(2015)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cancer/testis antigen 57 (CT57)
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.9 kDa
General Research Areas	Signal Transduction
Expression Region	1-366aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Cytoplasm, cytoskeleton
Tissue Specificity	Strongly expressed in testis and pancreas. Weak expression in placenta.
Gene Names	ACTL8
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP887982HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer