« Back
Home /
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

Item no.	CSB-YP888242CBG-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRA QENGAHLASIESNGEADFVSWLISQKDELADEDYV WIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKK CGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
Protein Family	Snaclec family
Citations	"Molecular cloning and sequence analysis of aggretin, a collagen-like platelet aggregation inducer."Chung C.-H., Au L.-C., Huang T.-F.Biochem. Biophys. Res. Commun. 263:723-727(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aggretin alpha chain; Rhodoaggretin subunit alpha
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	17.8 kDa
Relevance	Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Expression Region	1-136aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Subcellular Location	Secreted
Tissue Specificity	Expressed by the venom gland.
Sequence Info	Full Length
Organism	Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP888242CBG-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer