« Back
Home /
Recombinant Human Methionine synthase reductase(MTRR)

Recombinant Human Methionine synthase reductase(MTRR)

Item no.	CSB-YP890659HU-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Vitamines Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Solid
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLY ATQQGQAKAIAEEICEQAVVHGFSADLHCISESDK YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQN QTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDK RLQELGARHFYDTGHADDCVGLELVVEPWIAGLWP ALRKHFRSSRGQEEISGALPVASPASSRTDLVKSE LLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN VVI
Citations	Molecular cloning, expression and physical mapping of the human methionine synthase reductase gene.Leclerc D., Odievre M.-H., Wu Q., Wilson A., Huizenga J., Rozen R., Scherer S.W., Gravel R.A.Gene 240:75-88(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	82.4 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Metabolism
Relevance	Involved in the reductive regeneration of cob(I)alamin (vitamin B12) cofactor required for the maintenance of methionine synthase in a functional state. Necessary for utilization of methylgroups from the folate cycle, thereby affecting transgenerational epigenetic inheritance. Folate pathway donates methyl groups necessary for cellular methylation and affects different pathways such as DNA methylation, possibly explaining the transgenerational epigenetic inheritance effects.
Expression Region	1-725aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the reductive regeneration of cob(I)alamin (vitamin B12) cofactor required for the maintenance of methionine synthase in a functional state. Necessary for utilization of methylgroups from the folate cycle, thereby affecting transgenerational epigenetic inheritance. Folate pathway donates methyl groups necessary for cellular methylation and affects different pathways such as DNA methylation, possibly explaining the transgenerational epigenetic inheritance effects.
Subcellular Location	Isoform B: Cytoplasm, SUBCELLULAR LOCATION: Isoform C: Cytoplasm, SUBCELLULAR LOCATION: Isoform A: Cytoplasm
Tissue Specificity	Found in all tissues tested, particularly abundant in skeletal muscle.
Involvement in disease	Homocystinuria-megaloblastic anemia, cblE complementation type (HMAE); Neural tube defects, folate-sensitive (NTDFS)
Gene Names	MTRR
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP890659HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer