« Back
Home /
Recombinant Human Growth/differentiation factor 2(GDF2)

Recombinant Human Growth/differentiation factor 2(GDF2)

Manufacturer	Cusabio
Category	Neuroscience Neuroinflammation Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	50ug
Host	Yeast
Item no.	CSB-YP892325HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cell Biology
Uniprot ID	Q9UK05
Gene Names	GDF2
Organism	Homo sapiens (Human)
AA Sequence	HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRV NFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVT PTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVL YKDDMGVPTLKYHYEGMSVAECGCR
Expression Region	300-429aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	16.3 kDa
Alternative Name(s)	Bone morphogenetic protein 9 Short name: BMP-9
Relevance	Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
Reference	"Bone morphogenetic protein-9 is a circulating vascular quiescence factor."David L., Mallet C., Keramidas M., Lamande N., Gasc J.M., Dupuis-Girod S., Plauchu H., Feige J.J., Bailly S.Circ. Res. 102:914-922(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.
Involvement in disease	Telangiectasia, hereditary hemorrhagic, 5 (HHT5)
Subcellular Location	Secreted
Protein Families	TGF-beta family
Tissue Specificity	Detected in blood plasma (at protein level).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time