« Back
Home /
Recombinant Drosophila melanogaster Partner of bursicon(pburs)

Recombinant Drosophila melanogaster Partner of bursicon(pburs)

Item no.	CSB-YP893290DLU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRT CNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCC RESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRL REPTECKCFKCGDFTR
Citations	Drosophila molting neurohormone bursicon is a heterodimer and the natural agonist of the orphan receptor DLGR2.Mendive F.M., Van Loy T., Claeysen S., Poels J., Williamson M., Hauser F., Grimmelikhuijzen C.J.P., Vassart G., Vanden Broeck J.J.M.FEBS Lett. 579:2171-2176(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bursicon subunit beta
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	15.8 kDa
Relevance	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Expression Region	21-141aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Subcellular Location	Secreted
Tissue Specificity	Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with Burs in 4 bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system.
Gene Names	pburs
Sequence Info	Full Length of Mature Protein
Organism	Drosophila melanogaster (Fruit fly)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP893290DLU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer