« Back
Home /
Recombinant Human Protein-arginine deiminase type-2(PADI2)

Recombinant Human Protein-arginine deiminase type-2(PADI2)

Item no.	CSB-YP896493HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Solid
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPA GAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIP IDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSK EDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS AEL
Protein Family	Protein arginine deiminase family
Citations	Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 6:63-70(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PAD-H19Peptidylarginine deiminase IIProtein-arginine deiminase type II
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	77.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Catalyzes the deimination of arginine residues of proteins.
Expression Region	1-665aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the deimination of arginine residues of proteins.
Subcellular Location	Cytoplasm
Gene Names	PADI2
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP896493HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer