« Back
Home /
Recombinant Hepatitis E virus genotype 3 Capsid protein(ORF2),partial

Recombinant Hepatitis E virus genotype 3 Capsid protein(ORF2),partial

Item no.	CSB-YP897430HHAM-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KLYTSVENAQQDKGITIPHDIDLGDSRVVIQDYDN QHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEY DQTTYGSSTNPMYVSDTVTLVNVATGAQAVARSLD WSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYT TSLGAGPTSISAVGVLAPHSALAVLEDTIDYPARA HTFDDFCPECRTLGLQGCAFQSTIAELQRLKMKVG KTR
Protein Family	Hepevirus capsid protein family
Citations	"A hepatitis E virus variant from the United States: molecular characterization and transmission in cynomolgus macaques."Erker J.C., Desai S.M., Schlauder G.G., Dawson G.J., Mushahwar I.K.J. Gen. Virol. 80:681-690(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein ORF2
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.3 kDa
General Research Areas	Microbiology
Relevance	Major viral capsid protein that encapsidates the viral genome. Binds to the 5' end of the genomic RNA (By similarity).
Expression Region	411-660aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Major viral capsid protein that encapsidates the viral genome. Binds to the 5' end of the genomic RNA (By similarity).
Subcellular Location	Virion, Host cytoplasm, Host cell surface
Gene Names	ORF2
Sequence Info	Partial
Organism	Hepatitis E virus genotype 3 (isolate Human/United States/US2) (HEV-3)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP897430HHAM-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time