« Back
Home /
Recombinant Human Receptor-interacting serine/threonine-protein kinase 3(RIPK3)

Recombinant Human Receptor-interacting serine/threonine-protein kinase 3(RIPK3)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Microglia Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	Yeast
Item no.	CSB-YP897497HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cell Biology
Uniprot ID	Q9Y572
Gene Names	RIPK3
Organism	Homo sapiens (Human)
AA Sequence	MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTV FRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGL LQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTG SGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAEL PQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECL PKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRF SIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLN KLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTA GTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNC SGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQH PPPVGSQEGPKDPEAWSRPQGWYNHSGK
Expression Region	1-518aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	58.9 kDa
Alternative Name(s)	RIP-like protein kinase 3 Receptor-interacting protein 3 Short name: RIP-3
Relevance	Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production.
Reference	"Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB."Yu P.W., Huang B.C.B., Shen M., Quast J., Chan E., Xu X., Nolan G.P., Payan D.G., Luo Y.Curr. Biol. 9:539-542(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes
Subcellular Location	Cytoplasm, cytosol, Cell membrane, Mitochondrion
Protein Families	Protein kinase superfamily, TKL Ser/Thr protein kinase family
Tissue Specificity	Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
Paythway	TNFsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time