Comparison

PACAP 38, frog European Partner

Item no. RP10339-5
Manufacturer GenScript
Amount 5.0 mg
Quantity options 0.5 mg 5.0 mg
Category
Type Peptides
Specific against other
Purity > 95%
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{ILE}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10339-PACAP_38, PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products PACAP
Available
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide.
C-Terminal
NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5.0 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close