« Back
Home /
GDF15 Rabbit pAb (APR17324N)

GDF15 Rabbit pAb (APR17324N)

Item no.	LBI-APR17324N-2
Manufacturer	Leading Biology
Amount	100 ul
Quantity options	50 ul 100 ul 200 ul
Category	Immunoprecipitation Western Blot CHiP
Format	Liquid
Applications	WB, CHIP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Sequence	EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAK
Alias	GDF15, GDF-15, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Available
Manufacturer - Applications	WB (Homo sapiens) ChIP (Homo sapiens)
Manufacturer - Category	pAbs-N
Storage Conditions	Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Calculated MW: 34kDaObserved MW: 35KDa
Overview	We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality GDF15 Rabbit pAb (APR17324N).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 49-308 of human GDF15 (NP_004855.2).
Cellular localization	Secreted
Summary	The protein encoded by this gene belongs to the transforming growth factor-beta (TGF-beta) family. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress reponse program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.
Manufacturer - Format	Liquid
Storage Buffer	Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution	WB 1:500 - 1:2000IHC 1:50 - 1:100IF 1:50 - 1:200IP 1:50 - 1:200
Purification	Affinity purification
Positive Control	PC-3, HT-1080

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/20/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer