Comparison

GDF15 Rabbit pAb (APR17324N)

Item no. LBI-APR17324N-3
Manufacturer Leading Biology
Amount 200 ul
Quantity options 50 ul 100 ul 200 ul
Category
Format Liquid
Applications WB, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAK
Alias GDF15, GDF-15, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Available
Manufacturer - Applications
WB (Homo sapiens)
ChIP (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 34kDaObserved MW: 35KDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality GDF15 Rabbit pAb (APR17324N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 49-308 of human GDF15 (NP_004855.2).
Cellular localization
Secreted
Summary
The protein encoded by this gene belongs to the transforming growth factor-beta (TGF-beta) family. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress reponse program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IHC 1:50 - 1:100IF 1:50 - 1:200IP 1:50 - 1:200
Purification
Affinity purification
Positive Control
PC-3, HT-1080

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close