Comparison

[KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N)

Item no. LBI-APR20428N-3
Manufacturer Leading Biology
Amount 200 ul
Quantity options 50 ul 100 ul 200 ul
Category
Format Liquid
Applications IP
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Sequence LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Alias ENX-1, ENX1, EZH1, EZH2b, KMT6, KMT6A, WVS, WVS2, EZH2, KMT6 / EZH2
Available
Manufacturer - Applications
IP (Homo sapiens)
Manufacturer - Category
pAbs-N
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Molecular Weight
Calculated MW: 79kDa/81kDa/84kDa/85kDa/86kDaObserved MW: 105kDa
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.This product is a high quality [KO Validated] EZH2/KMT6 Rabbit pAb (APR20428N).
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2/KMT6 (NP_001190176.1).
Cellular localization
Nucleus
Summary
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Manufacturer - Format
Liquid
Storage Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH 7.3.
Dilution
WB 1:500 - 1:2000IP 1:50 - 1:100
Purification
Affinity purification

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close