« Back
Home /
β-CGRP, human (TFA)

β-CGRP, human (TFA)

Item no.	HY-P1548A-5mg
Manufacturer	MedChem Express
Amount	5 mg
Quantity options	1 mg 500 ug 5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Specific against	other
Purity	99.17
Citations	[1]McLatchie LM, et al. RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393(6683):333-9.\|[2]Russell FA, et al. Calcitonin gene-related peptide: physiology and pathophysiology. Physiol Rev. 2014 Oct;94(4):1099-142.
Smiles	[ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7) (TFA salt)]
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Human β-CGRP (TFA),CGRP-II (Human) (TFA)
Shipping Condition	Cool pack
Available
Manufacturer - Type	Peptides
Manufacturer - Applications	COVID-19-immunoregulation
Manufacturer - Targets	CGRP Receptor
Shipping Temperature	Blue Ice
Storage Conditions	-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
Molecular Weight	3793.41 (free base)
Product Description	β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].
Manufacturer - Research Area	Inflammation/Immunology; Cardiovascular Disease
Solubility	H2O: 100 mg/mL (ultrasonic)
Manufacturer - Pathway	GPCR/G Protein; Neuronal Signaling
Clinical information	No Development Reported

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

HY-P1548A-5mg-safety-datasheet.pdf