Comparison

AmmTx3 European Partner

Item no. ALO-STA-305-1mg
Manufacturer Alomone
Amount 1 mg
Quantity options 0.1 mg 0.25 mg 0.5 mg 10 mg 1 mg 50 ug 5 mg
Category
Type Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence ZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
KV4 K+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
3822 Da
Manufacturer - Format
Lyophilized
Short description
A Blocker of A-Type K+ Channels
Description
Potassium channel toxin α-KTx 15.3 - A Blocker of A-Type K+ Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Blocker of A-Type K+ Channels

PH
7, 4
UNSPSC
12352202
Origin
Androctonus mauritanicus mauritanicus (Scorpion)
Modifications

Disulfide bonds between: Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35

Z= Pyrrolidone carboxylic acid

Effective Concentration
1 - 5 µM
Activity
AamTx3 Toxin is a blocker of A-type voltage-gated K+ channels as well as ERG1, KV11.1 and KCNH2 K+ channels1, 2.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
AmmTX3 is a member of the α-KTX15 family of scorpion toxins which includes 6 homologous peptides found in four species of scorpion venoms -Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. AmmTx3 shares homology of 94% with Aa1 and 91% with BmTx3 and is originally isolated from the venom of the scorpion Androctonus mauretanicus. This toxin selectively blocks A-type K+ channels in cerebellum granular cells or cultured striatum neurons from rat brain.AmmTx3 is a pore blocker of KV4.2 and KV4.3 subunits and requires for its action the expression of the KV4 associated protein dipeptidyl peptidase-like proteins 6 (DPP6). AmmTX3 structure consists of a single chain of 37 amino acid residues cross-linked by three disulphide bridges1, 2.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close