Comparison

Agitoxin-3 European Partner

Item no. ALO-STA-390-1mg
Manufacturer Alomone
CASRN 155646-23-4
Amount 1 mg
Quantity options 0.1 mg 0.5 mg 10 mg 1 mg 50 ug 5 mg
Category
Type Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence GVPINVPCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
KV1.3 K+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
4101 Da
Manufacturer - Format
Lyophilized
Short description
A Potent Blocker of KV1.3 K+ Channels
Description
K+ channel toxin α-KTx 3.3, AgTx-3, AgTx3 - A Potent Blocker of KV1.3 K+ Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Potent Blocker of KV1.3 K+ Channels

PH
7, 4
UNSPSC
12352202
Origin
Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)
Modifications
Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35
Effective Concentration
50 pM - 10 nM
Activity
Agitoxin-3 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Agitoxins are peptide toxins originally isolated from L. quinquestriatus hebraeus scorpion venoM This group of toxins blocks potassium (K⁺) channels and has a central role in the investigation and understanding of the physiological importance of K+ channels and their function in membrane biophysics1.Agitoxins 1, 2 and 3 have been isolated and characterized. Each toxin is comprised of 38 amino acids. They are highly homologous and differ only in the identity of the residues at positions 7, 15, 29 and 31.Agitoxins appear to be specific for the Shaker K+ channel of Drosophila melanogaster and many of the mammalian homologues of Shaker. Agitoxin-1 blocks the Shaker channel in a stoichiometry of one to one, it binds the channel site in the extracellular vestibule and prevents ion conduction by occluding the pore2.Using scorpion toxins for molecular dissection of ion channels has led to direct evidence that specific mutations can be correlated to changes in the propagation and conduction of electrical impulses in the body3.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close