Comparison

Ceratotoxin-2 European Partner

Item no. ALO-STC-100-50ug
Manufacturer Alomone
Amount 50 ug
Quantity options 0.1 mg 0.5 mg 10 mg 1 mg 50 ug 5 mg
Category
Type Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH<sub>2</sub>
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
NaV channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
4092.7 Da
Manufacturer - Format
Lyophilized
Short description
A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels
Description
β-Theraphotoxin-Cm1b, β-TRTX-Cm1b, CcoTx2 - A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels

PH
7, 4
UNSPSC
12352202
Origin
Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)
Modifications

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29

Leu33 - C-terminal amidation

Effective Concentration
5 nM - 2 µM
Activity
Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close