Comparison

Hm3a European Partner

Item no. ALO-STH-250-0.1mg
Manufacturer Alomone
Amount 0.1 mg
Quantity options 0.1 mg 0.5 mg 1 mg 50 ug 5 mg
Category
Type Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence EPCIPKWKSCVNRHGDCCAGLECWKRRKSFEVCVPKV-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
ASIC1a and ASIC1b
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
4287 Da
Manufacturer - Format
Lyophilized
Short description
A Highly Potent ASIC1a Blocker and ASIC1b Activator
Description
Pi-theraphotoxin-Hm3a, Pi-TRTX-Hm3a - A Highly Potent ASIC1a Blocker and ASIC1b Activator
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Highly Potent ASIC1a Blocker and ASIC1b Activator

PH
7, 4
UNSPSC
12352202
Origin
Heteroscodra maculata (Togo starburst tarantula) (Togo starburst baboon spider)
Modifications

Disulfide bonds between Cys3- Cys18, Cys10- Cys23, Cys17- Cys33

Effective Concentration
1 - 200 nM
Activity
Hm3a Toxin acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Hm3a is a 37-amino acid peptide toxin originally isolated from the venom of Togo starburst tarantula (Heteroscodra maculata) and acts as a potent ASIC1a channel blocker with an IC50 value of 1-2 nM and ASIC1b channel activator with an EC50 value of 46.5 nM1. Studies reveal that Glu177 and Arg175 in the palm region opposite α-helix 5 play an important role in the interaction between Hm3a and ASIC1 and contribute to the subtype-dependent effects of the peptide. Hm3a is a useful tool for studying ASICs1.Acid-sensing ion channels (ASICs) are voltage-independent proton-gated amiloride sensitive sodium channels, belonging to the DEG/ENaC gene family, activated by a drop in extracellular pH. ASIC1a is a promising therapeutic target1, 2.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close