Comparison

ProTx-II European Partner

Item no. ALO-STP-100-0.5mg
Manufacturer Alomone
CASRN 484598-36-9
Amount 0.5 mg
Quantity options 0.1 mg 0.25 mg 0.5 mg 100 mg 10 mg 1 mg 250 mg 50 ug 5 mg
Category
Type Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence YCQKWMWTCDSERKCCEGMVCRLWCKKKLW-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
NaV channels and T-type Ca2+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
3826.6 Da
Manufacturer - Format
Lyophilized
Short description
A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels
Description
β/ω-Theraphotoxin-Tp2a, Protoxin-2, PT-II, ProTx2, Protoxin2, ProTx II - A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Blocker of NaV1.7 and NaV1.5 Channels and Some T-Type Ca2+ Channels

PH
7, 4
UNSPSC
12352202
Origin
Thrixopelma pruriens (Peruvian green velvet tarantula)
Modifications
Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25
Effective Concentration
10 - 500 nM
Activity
ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations2.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
ProTx-II is a peptidyl toxin originally produced in Thrixopelma pruriens, the Peruvian green velvet tarantula. It was identified as a voltage-gated Na+ channel (NaV) blocker which inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant channels1.Binding of ProTx-II to an extracellular domain of NaV channel, probably to a hydrophobic site3, inhibits current by shifting the channel activation to more positive potentials1-2.ProTx-II Inhibits NaV1.2, NaV1.3, NaV1.5, NaV1.6, NaV1.7, and NaV1.8. It is a significantly more potent inhibitor against NaV1.7 than the other NaV channel subtypes1.ProTx-II was also found as an effective modulator which shifts the voltage dependence activity of T-type Ca2+ channel1.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Delivery expected until 1/8/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close