Comparison

Tityustoxin-Kalpha-ATTO Fluor-594 European Partner

Item no. ALO-STT-360-AR-5x5ug
Manufacturer Alomone
Amount 5 x 5 ug
Quantity options 5 ug 5 x 5 ug
Category
Type Molecules
Format Lyophilized
Applications FC, IF
Specific against other
Conjugate/Tag Texas Red, Rhodamine
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry
Manufacturer - Category
Proteins
Manufacturer - Targets
KV1.2 K+ channels
Manufacturer - Conjugate / Tag
ATTO-594. Maximum absorption 601 nm; Maximum fluorescence 627 nM The fluorescence is excited most efficiently in the 580 - 615 nm range. This label belongs to the class of Rhodamine dyes and can be used with fluorescent equipment typically optimized to detect Texas Red and Alexa-594. The extent of labeling is 1-3 molecules of dye per molecule of Tityustoxin-Kα.
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
Storage Conditions
Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. - Storage after Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Molecular Weight
~4900 Da
Manufacturer - Format
Lyophilized
Short description
A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594
Description
K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9 - A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Specificity

A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594

PH
7, 4
UNSPSC
12352202
Origin
Tityus serrulatus (Brazilian scorpion)
Modifications

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35

Ala20 was replaced by Cysteine (bold in the sequence).

ATTO Fluor-594

Effective Concentration
0.5 - 50 nM
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1, 2.Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Tityustoxin Kα (#STT-360) is a potent and specific blocker of KV1.2 channels1, 2. It was originally isolated from the scorpion Tityus serrulatus venom2.The labeled version of the toxin, Tityustoxin-Kα-ATTO Fluor-594, has been tested in electrophysiology applications and is specially suited to experiments requiring simultaneous labeling of different markers.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 x 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close