Comparison

human GALP (3-32) European Partner

Item no. ALO-GPG-250-10mg
Manufacturer Alomone
Amount 10 mg
Quantity options 10 mg 1 mg 2.5 mg 5 mg
Category
Type Peptides
Format Lyophilized
Applications FA
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence AHRGRGGWTLNSAGYLLGPVLHLPQMGDQ-OH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Aequorin functional assay / Calcium imaging assay
Manufacturer - Category
Proteins
Manufacturer - Targets
Galanin receptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
3102 Da
Manufacturer - Format
Lyophilized
Short description
A Non-Selective and Potent Agonist of Galanin Receptors
Description
Galanin-like peptide (3-32) - A Non-Selective and Potent Agonist of Galanin Receptors
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Non-Selective and Potent Agonist of Galanin Receptors

PH
7, 4
UNSPSC
12352202
Effective Concentration
1 - 50 nM
Activity
Human GALP (3-32) is a Galanin receptor agonist1.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Human GALP (3-32) fragment is a human galanin-like peptide that acts as a non-selective and potent galanin receptor agonist. Human GALP consists of 60 amino acid with a potential proteolytic cleavage site between two basic amino acids in position 33.Human GALP (3-32) shares amino acids in position 9-21 with the first 13 amino acids of galanin, an essential sequence for activating galanin receptors1, 2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.Human GALP (3-32) is at least as potent as full length GALP. Studies suggest that GALP (3-32) fragment can represent the strongest mediator of biological GALP activity. GALP (3-32) can be used as a useful tool for studding the affinity of GALP to galanin receptors and to search for specific GALP receptors1, 2. Human GALP (3-32) displays highest affinity to GalR3 with an IC50 value of 10 nM, followed by GalR2 with IC50 of 28 nM and GalR1 with IC50 of 77 nM1.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close