« Back
Home /
omega-Agatoxin IVA-ATTO Fluor-647N

omega-Agatoxin IVA-ATTO Fluor-647N

Item no.	ALO-STA-500-FRN-5x10ug
Manufacturer	Alomone
Amount	5 x 10 ug
Quantity options	10 ug 10 x 10 ug 2 x 10 ug 5 ug 5 x 10 ug
Category	Metabolism Diabetes Peptides & Proteins Flow Cytometry Immunofluorescence Native Proteins
Type	Proteins Native
Format	Lyophilized
Applications	FC, IF
Specific against	other
Conjugate/Tag	ATTO 647
Formula	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence	KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Shipping Condition	Room temperature
Available
Manufacturer - Type	Non Antibodies
Manufacturer - Applications	Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry
Manufacturer - Category	Proteins
Manufacturer - Targets	P-type Ca2+ channels
Manufacturer - Conjugate / Tag	ATTO-647N. ATTO dyes are characterized by strong absorption (high extinction coefficient), high fluorescence quantum yield, and high photo-stability. Maximum absorption 646 nm; maximum fluorescence 664 nm. The fluorescence is excited most efficiently in the range 625 - 660 nm. A suitable excitation source is the 647 nm line of the Krypton-Ion laser or a diode-laser emitting at 650 nm. It can be used in flow cytometry (FACS) using the red (637 nm) laser. The extent of labeling is 1-2 molecules of dye per ω-Agatoxin IVA molecule.
Country of Origin	Israel
Shipping Temperature	The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
Storage Conditions	Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. - Storage after Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Molecular Weight	~6144 Da
Manufacturer - Format	Lyophilized
Short description	A Fluorescent Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels
Description	Omega-agatoxin-Aa4a, ω-AGTX-Aa4a, ω-Aga-IVA, ω-agatoxin-4A - A Fluorescent Conjugate Marker for Sensitive Detection of P/Q-Type CaV Channels
Reconstitution	Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
PH	7, 4
UNSPSC	12352202
Origin	Agelenopsis aperta (North American funnel-web spider) (Agelenopsis gertschi)
Modifications	Disulfide bonds between: Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34 ATTO Fluor-647N
Effective Concentration	0.5 – 3 µM
Activity	ω-Agatoxin IVA is a blocker of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presynaptically in a variety of synapses2, 3.
Solubility	The product is lyophilized in 0.5 ml conical vial.Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes). The lyophilizate may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. Soluble in pure water at high-micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, it is recommended to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations at 10, 000 x g for 5 minutes before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light
Sterile endotoxin free	no
Bioassay tested	yes
Scientific Background	Native ω-Agatoxin IVA (ω-Aga-IVA) was originally isolated from Agelenopsis aperta spider venom, and was shown to be a selective blocker of CaV2.1 (P/Q type) channels1. However, the sensitivity depends on the auxiliary b subunit isoform2 and on the splice variant3. Therefore, the effective concentration varies between systems. In accordance, the toxin blocks presynaptic Ca2+ currents and synaptic transmission in a variety of synapses4, 5. ω-Agatoxin IVA is widely used in electrophysiological measurements of cloned and native channels6, 7. It is used to assess the role of CaV2.1 channels in synaptic transmission4. In addition, it was used to map the spatial distribution of CaV2.1 channels in mouse cerebellar and hippocampal brain slices8.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

ALO-STA-500-FRN-5x10ug-safety-datasheet.pdf