Comparison

Recombinant Human CD276 antigen (CD276), partial (Active)

Item no. CSB-MP733578HU-1mg
Manufacturer Cusabio
Amount 1 mg
Quantity options 100 ug 1 mg 20 ug
Category
Type Proteins Recombinant
Specific against other
Conjugate/Tag Myc
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 4Ig-B7-H3 (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD276)
Available
Manufacturer - Type
Active Protein & In Stock Protein
Manufacturer - Category
Proteins / Recombinant Protein
Manufacturer - Conjugate / Tag
C-terminal hFc-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Molecular Weight
53.4 kDa
Buffer
Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
General Research Areas
Cancer
Relevance
May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.
Expression Region
29-245aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Gene Names
CD276
Organism
Homo sapiens (Human)
Activity
Yes
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close