Item no. |
NOVP-C152-10ug |
Manufacturer |
Novoprotein Scientific
|
Amount |
10 ug |
Quantity options |
10 ug
1 mg
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid |
Specific against |
Escherichia coli (E.coli) |
Host |
E.coli |
Conjugate/Tag |
HIS |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPAN RFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLV DRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALA ILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPN PSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
G/U Mismatch-Specific DNA Glycosylase, Double-Strand-Specific Uracil Glycosylase, Mismatch-Specific Uracil DNA-Glycosylase, MUG, mug, ygjF |
Similar products |
mug-glycosylase |
Available |
|
Background |
E. coli Mismatch Uracil DNA Glycosylase (Mug protein) is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3, N4-ethenocytosine & removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA & the mispaired base. The complementary strand guanine functions in substrate recognition. It is required for DNA damage lesion repair in stationary-phase cells. |
Description |
Recombinant E.coli Mug is produced by our E.coli expression system & the target gene encoding Met1-Arg168 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 2.5mM beta-ME, 1mM PMSF, 50% Glycerol, pH 8.0. |
Molecular Weight |
19, 74 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Met1-Arg168 |
Ship Description |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.