Comparison

[Novoprotein] Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug (C-6His)

Item no. NOVP-C152-500ug
Manufacturer Novoprotein Scientific
Amount 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Escherichia coli (E.coli)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Dry ice Yes
Sequence MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPAN RFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLV DRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALA ILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPN PSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias G/U Mismatch-Specific DNA Glycosylase,Double-Strand-Specific Uracil Glycosylase,Mismatch-Specific Uracil DNA-Glycosylase,MUG,mug,ygjF
Similar products mug-glycosylase
Available
Shipping Temperature
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Molecular Weight
19, 74
Description
Recombinant E.coli Mug is produced by our E.coli expression system & the target gene encoding Met1-Arg168 is expressed with a 6His tag at the C-terminus.
Formulation
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 2.5mM beta-ME, 1mM PMSF, 50% Glycerol, pH 8.0.
Background
E. coli Mismatch Uracil DNA Glycosylase (Mug protein) is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3, N4-ethenocytosine & removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA & the mispaired base. The complementary strand guanine functions in substrate recognition. It is required for DNA damage lesion repair in stationary-phase cells.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Met1-Arg168

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close