Comparison

[Novoprotein] Recombinant Mouse Interleukin-11/IL-11 (C-6His)

Item no. NOVP-C757-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQL AAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLP GVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPEL GALQARLERLLRRLQLLMSRLALPQAAPDQPVIPL GPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLK TRLVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-11,IL-11,IL11
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
20, 2
Description
Recombinant Mouse Interleukin-11 is produced by our Mammalian expression system & the target gene encoding Pro22-Leu199 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Interleukin-11(IL-11) is a secreted protein & belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation & differentiation & could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness & strength of long bones. In addition to having lymphopoietic/hematopoietic & osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis & bone.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Pro22-Leu199

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close