Comparison

[Novoprotein] Recombinant Human Cocaine- & Amphetamine-Regulated Transcript/CARTPT (C-6His)

Item no. NOVP-CA65-10ug
Manufacturer Novoprotein Scientific
Amount 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host HEK293
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence QEDAELQPRALDIYSAVDDASHEKELIEALQEVLK KLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIG KLCDCPRGTSCNSFLLKCLVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cocaine- & Amphetamine-Regulated Transcript Protein,CARTPT,CART
Similar products CART
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
10, 98
Description
Recombinant Human CARTPT is produced by our Mammalian expression system & the target gene encoding Gln28-Leu116 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
Cocaine- & Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, & also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin & neuropeptide Y. This anorectic peptide inhibits both normal & starvation-induced feeding & completely blocks the feeding response induced by neuropeptide Y & regulated by leptin in the hypothalamus. CARTPT promotes neuronal development & survival in vitro.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Gln28-Leu116

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close