Comparison

Recombinant Human CD99/MIC2 (C-Fc)

Item no. NOVP-CD09-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGD AVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSD ADLADGVSGGEGKGGSDGGGSHRKEGEEADVDDIE GRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD99 Antigen,12E7,E2 Antigen,Protein MIC2,T-Cell Surface Glycoprotein E2,CD99,MIC2,MIC2X,MIC2Y
Similar products CD99
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
37, 2
Description
Recombinant Human CD99 is produced by our Mammalian expression system & the target gene encoding Asp23-Asp122 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Background
CD99 is a type I transmembrane glycoprotein & the founding member of the CD99 family of molecules. The extracellular domain of CD99 contains no identifiable motifs, its cytoplasmic region, although short, does have signal transduction capability. Cells known to express CD99 include fibroblasts, neutrophils, T cells, double positive thymocytes, CD34+ stem cells, monocytes & endothelial cells. Two types of CD99 isoforms have been classified. Native human CD99 is referred to as the long, or type I isoform. The best studied type II isoform shows an Asp-Gly substitution for the C terminal 27 amino acids. The type I & II isoforms have distinctive signal transduction pathways (FAKsrc for type I PI3K plus srcERK1/2 for type II), & mediate clearly different biological outcomes. Homophilic interaction between CD99 on the neutrophil & CD99 on the endothelial cell regulates the transendothelial migration of neutrophils during inflammation. Human CD99 has 48% aa sequence identity to mouse CD99.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Asp23-Asp122

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close