Comparison

Recombinant Mouse VEGF-A/VEGF164

Item no. NOVP-CD73-1mg
Manufacturer Novoprotein Scientific
Amount 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Conjugate/Tag Unconjugated
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIF QEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPT SESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRP KKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKN TDSRCKARQLELNERTCRCDKPRR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Vascular endothelial growth factor A,VEGF-A,Vascular permeability factor,VPF,VEGFA,VEGFA164,VEGF164
Similar products VEGF-A164
Shipping Condition Room temperature
Available
Manufacturer - Host
Pichia Pastoris
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
19, 27
Description
Recombinant Mouse Vascular Endothelial Growth Factor A is produced by our Yeast expression system & the target gene encoding Ala27-Arg190 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Background
Mouse Vascular endothelial growth factor (VEGF or VEGF­A), is a potent mediator of both angiogenesis & vasculogenesis in the fetus & adult. It is a member of the PDGF/VEGF growth factor family that is characterized by a cystine knot structure formed by eight conserved cysteine residues. Alternately spliced isoforms of 120, 164 & 188 aa found in mouse. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt­1) & VEGF R2 (Flk­/KDR) on endothelial cells.Although affinity is highest for binding to VEGF R1, VEGF R2 appears to be the primary mediator of VEGF angiogenic activity. VEGF is required during embryogenesis to regulate the proliferation, migration, & survival of endothelial cells.It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis.
Biological Activity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED50 for this effect is typically 1­4ng/mL, Corresponding to a specific activity of >= 2.5 x 105 units/mg.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ala27-Arg190

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close