Comparison

Recombinant Mouse Lymphotoxin beta Receptor/LTBR/TNFRSF3/TNFRrp (C-Fc)

Item no. NOVP-CD78-500ug
Manufacturer Novoprotein Scientific
Amount 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRC PPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLST CQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSC VYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDV NCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAA PGTSYSDTICKNPPEPVDDIEGRMDEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 3,Lymphotoxin-beta receptor,Ltbr,Tnfcr,Tnfrsf3
Similar products TNFRSF3
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
48, 7
Description
Recombinant Mouse Lymphotoxin beta Receptor is produced by our Mammalian expression system & the target gene encoding Ser28-Pro218 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
It is a single-pass type I membrane protein & contains 4 TNFR-Cys repeats. The protein is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial & myeloid lineages, but not on T & B lymphocytes. The protein is the receptor for the heterotrimeric lymphotoxin containing LTA & LTB, & for TNFS14/LIGHT. It promotes apoptosis via TRAF3 & TRAF5 & may play a role in the development of lymphoid organs. The encoded protein & its ligand play a role in the development & organization of lymphoid tissue & transformed cells. Activation of the encoded protein can trigger apoptosis. Not only does the TNFRSF3 help trigger apoptosis, it can lead to the release of the cytokine interleukin 8. Overexpression of TNFRSF3 in Human Cells cells increases IL-8 promoter activity & leads to IL-8 release. TNFRSF3 is also essential for development & organization of the secondary lymphoid organs & chemokine release.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ser28-Pro218

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close