« Back
Home /
[Novoprotein] Recombinant Human Interleukin-17B/IL-17B (C-6His)

[Novoprotein] Recombinant Human Interleukin-17B/IL-17B (C-6His)

Item no.	NOVP-CK30-10ug
Manufacturer	Novoprotein Scientific
Amount	10 ug
Quantity options	10 ug 1 mg 500 ug 50 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	Human
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKP YARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQL WMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLG CVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRT GPCRQRAVMETIAVGCTCIFVDHHHHHH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17B, interleukin-17 beta, interleukin-17B, interleukin 17B, IL20, IL-20, interleukin 20 Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-Cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17Binterleukin-17 beta, IL20, IL-20interleukin-17B, interleukin 17B, interleukin 20, Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-
Available
Background	Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses & inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E & IL-17F. The six IL-17 cytokines are highly conserved at C terminus, & contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine & chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) & induces the production of inflammatory cytokines & the infiltration of inflammatory immune cells.
Description	Recombinant Human Interleukin-17B is produced by our Mammalian expression system & the target gene encoding Gln21-Phe180 is expressed with a 6His tag at the C-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Molecular Weight	19, 2
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Gln21-Phe180
Ship Description	The product is shipped at ambient temperature.
Storage	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 7/17/2025

Express Delivery: Save 31 days

Compare

Add to wishlist

Recommend by mail