Comparison

Recombinant human Mitochondrial import inner membrane translocase subunit TIM16

Item no. OPCA00306-1MG
Manufacturer AVIVA Systems Biology
Amount 1 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Citations Identification and characterization of Magmas, a novel mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction.Jubinsky P.T., Messer A., Bender J., Morris R.E., Ciraolo G.M., Witte D.P., Hawley R.G., Short M.K.Exp. Hematol. 29:1392-1402(2001)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CGI-136;MAGMAS;magmas-like protein;mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction;mitochondria-associated granulocyte macrophage CSF-signaling molecule;mitochondrial import inner membrane translocase subunit TIM16;presequence translocase associated motor 16 homolog;Presequence translocated-associated motor subunit PAM16;SMDMDM;TIM16;TIMM16.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
40.8 kDa
Gene symbol
PAM16
Gene Fullname
presequence translocase associated motor 16
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Protein name
Mitochondrial import inner membrane translocase subunit TIM16
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close